PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008226286.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 322aa    MW: 36189.1 Da    PI: 8.4545
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008226286.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.31e-51111351129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhP+deelv++yL kkv++++ +l   + evd++k+ePw++p ++  + kewyf+s+rd+kyatg r+nrat++gyWkatgkd+++l+ 
  XP_008226286.1  11 LPPGFRFHPRDEELVCDYLLKKVTQTDSTL---MIEVDLNKCEPWEIPVNACVGGKEWYFYSQRDRKYATGLRTNRATAAGYWKATGKDRPILR- 101
                     79***********************99666...889************7666789**************************************9. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                     kg+lvg++ktLvfy+grapkg+k+dWvmhe+rle
  XP_008226286.1 102 KGSLVGMRKTLVFYQGRAPKGRKSDWVMHEFRLE 135
                     999****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-582158IPR003441NAC domain
PROSITE profilePS5100555.37211158IPR003441NAC domain
PfamPF023651.1E-2612134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MSNISMVEAK LPPGFRFHPR DEELVCDYLL KKVTQTDSTL MIEVDLNKCE PWEIPVNACV  60
GGKEWYFYSQ RDRKYATGLR TNRATAAGYW KATGKDRPIL RKGSLVGMRK TLVFYQGRAP  120
KGRKSDWVMH EFRLEGPLGP PKISSHKEDW VLCRVFCKNR EIAAKPSMGI SRYDDTSNSS  180
LPALMDSYIS FDGQPQTQPQ PQPHHEYEQV PCFSIFSQSQ TSPIFSHIDI TGAHLEPNMP  240
TKNNNNNPAT FGALPNVTSF LDPFSCDKKV LKAVLSHLTK MEETSSYPTL NVKGSSPPSL  300
GAGSSSENYL SEVGMPNIWS HY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-50615912166NO APICAL MERISTEM PROTEIN
1ut4_B7e-50615912166NO APICAL MERISTEM PROTEIN
1ut7_A7e-50615912166NO APICAL MERISTEM PROTEIN
1ut7_B7e-50615912166NO APICAL MERISTEM PROTEIN
4dul_A7e-50615912166NAC domain-containing protein 19
4dul_B7e-50615912166NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008226286.10.0PREDICTED: NAC domain-containing protein 21/22
SwissprotQ84TE61e-115NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLM5WHT70.0M5WHT7_PRUPE; Uncharacterized protein
STRINGGLYMA15G40510.11e-161(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100103241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.21e-110NAC domain containing protein 1